PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 452aa    MW: 48862.2 Da    PI: 10.5615
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1751genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.68.6e-16374425556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+  e+ ++ 
  Gh_A05G1751 374 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRKKHAEIMEMQ 425
                  79*****************************************999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-12370431IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.519372423IPR004827Basic-leucine zipper domain
PfamPF001701.3E-13374425IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.06E-11374423No hitNo description
Gene3DG3DSA:1.20.5.1703.5E-15374423No hitNo description
CDDcd147071.13E-26374428No hitNo description
PROSITE patternPS000360377392IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MKKTNQHLAL PRRPKRRPKK QPEAQIILNL KNKILMGTNM NFGSNPPPSG DCGGNKPPGN  60
NLLTRQPSIY SLTFDEFQST MGGIGKDFGS MNMDELLRNI WSAEEIQTMA SSGGVLEGNG  120
GLQRQGSLTL PRTLSQKTVD EVWKDISKEY SLGKDGIGGG GGTNNMPQRQ QTLGEMTLEE  180
FLVRAGVVRE DTQLAGKVNN GGFFGGNNTG FEIGFQQGGK GPNLMGTRIP DGGNQIGIQA  240
SNLHPNVNGV RSNQHQLAQQ HQHQQPIFPK QTGVGYGAQI PLQSGGQLGS PGIRSGMHGI  300
GDQGISNGLI QAGALQGGGM GMVGLGTGSP ANQLSSDGIG KSSGDTSSVS PVPYVFNGSM  360
RGRKYSAVEK VAERRQRRMI KNRESAARSR ARKQAYTMEL EAEVAKLKEE NQELRKKHAE  420
IMEMQKNQVI EMVDMQQGAK KRCLRRTQTG PW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11119RRPKRRPKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.248470.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445168.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-139AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0B0PLL00.0A0A0B0PLL0_G
STRINGPOPTR_0002s12710.11e-174(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-113abscisic acid responsive elements-binding factor 2